DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP16F and RGA1

DIOPT Version :9

Sequence 1:NP_001285400.1 Gene:RhoGAP16F / 32790 FlyBaseID:FBgn0030893 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_014770.1 Gene:RGA1 / 854294 SGDID:S000005653 Length:1007 Species:Saccharomyces cerevisiae


Alignment Length:644 Identity:124/644 - (19%)
Similarity:216/644 - (33%) Gaps:238/644 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QTTTSQRPVTP------GTPDSAHIVIGAAGFVAHERRQPGKTLMNCFRDRSTTSSSSSQAQHAY 60
            :|...||||..      ..||.|.        |..|:.:......|..:.|..:.|.|.:::...
Yeast   371 ETNALQRPVVEVVKEDRSVPDLAG--------VQQEQAEKYSYSNNSGKGRKISRSLSRRSKDLM 427

  Fly    61 VRGHSVTSSTLFRLEGSGGSNCTLDKAGKQDTGRPEAVVLLRELKT---RPNKLALLKSSSSKDL 122
            :...|       |..|...||..|..|.|..:.|.:.::...:..|   .||     .:|:|.|:
Yeast   428 INLKS-------RATGKQDSNVKLSPASKVTSRRSQDLMRDNDSHTGLDTPN-----SNSTSLDI 480

  Fly   123 T---------RLFLDDSTNTAVLVSNTSIDVCSSNSSSGGSPAVGRSKSGR-------------- 164
            .         :.|.|:.|........|:::...::|....||.....:|..              
Yeast   481 LVNNQKSLNYKRFTDNGTLRVTSGKETALEEQKNHSFKSPSPIDHLLQSPATPSNVSMYRTPPLD 545

  Fly   165 -----DRRNGLECCSSCSKR------W--------------HDLKQRMH---------TLEQDLL 195
                 |||||    ||.|.:      |              .:.|:.::         :|:::::
Yeast   546 SSLTFDRRNG----SSYSNQNYSIPSWQKTPKTQLENSDNFEEQKETLYENSESRNDPSLDKEIV 606

  Fly   196 VQTTY-------SQELEQKVGEMSRQLTELLQERDRER--------DKDK--------------- 230
            ....|       .:|||.:..|:.:::||:...::..|        :|:|               
Yeast   607 TAEHYLKQLKINLKELESQREELMKEITEMKSMKEALRRHIESYNSEKNKLYLDSNELSNNPPMI 671

  Fly   231 -----------ARFAAAGGVA-------------------------------------------A 241
                       ...|.|..||                                           |
Yeast   672 NEISLGESPPVKHVATASSVARSSVKPKFWKFFSSAKPQTEQSIQGVSTNNTNSIVKSAPVLLSA 736

  Fly   242 PGKRTAHGSPNVRPS-----------RLVAWMNLSNWFKSRPSVETLREQRIFFDEPCFDTELEM 295
            |...:..|...:.|.           |||...|.:|..:|:...|.|....::..        .:
Yeast   737 PSSGSNSGRLEISPPVLQNPNEFSDVRLVPIENDANMGQSKDGEEYLDGSNLYGS--------SL 793

  Fly   296 VLK-HDQHRTVPRIVVDCCDLIE--QKYRRSTQPIEGIYRQCGDYNKIQTLRFSIDA-NDYDSLR 356
            |.: :.::..:|.|:..|.|.||  ::..||    |||||:.|....|:.:.....| ....:..
Yeast   794 VARCNYENNEIPMILSVCIDFIESDEENMRS----EGIYRKSGSQLVIEEIEKQFSAWKVQQNTE 854

  Fly   357 QPDV----DIHTLTGVLKLFLR---------EIKSPLVRVNEAK------TFIGQPNQWLL---- 398
            .|::    |::.:|||||.:||         :|..||:|:.::|      .|:|  .:..|    
Yeast   855 TPNILTEQDLNVVTGVLKRYLRKLPNPIFTFQIYEPLMRLVKSKKMMENLPFVG--GKLSLEAKN 917

  Fly   399 --TDLSAKLDSLKRLIRSLPESN----RDTMDYI-----FGHFNRITKVPLQQISAETL 446
              |.:|:| .:||.::..||..:    |...::|     :.|:||:|...|..:.|..|
Yeast   918 SDTYMSSK-SALKNILEDLPREHYRVLRVLSEHIEKVTRYSHWNRMTLYNLALVFAPGL 975

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP16FNP_001285400.1 RhoGAP 306..487 CDD:238090 49/178 (28%)
RGA1NP_014770.1 LIM1_Rga 13..67 CDD:188780
LIM2_Rga 70..123 CDD:188781
Smc <569..>673 CDD:224117 12/103 (12%)
RhoGAP 803..1002 CDD:214618 49/180 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23176
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.