DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP16F and Arhgap15

DIOPT Version :9

Sequence 1:NP_001285400.1 Gene:RhoGAP16F / 32790 FlyBaseID:FBgn0030893 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_722542.2 Gene:Arhgap15 / 76117 MGIID:1923367 Length:481 Species:Mus musculus


Alignment Length:209 Identity:64/209 - (30%)
Similarity:106/209 - (50%) Gaps:19/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 LSNWFKSRPSVETLREQRIFFDEPCFDTELEMVLKHDQHRTVPRIVVDCCDLIEQKYRRSTQPIE 328
            |..:...|||::||:|:.:..|: .|.:.|..|.:. :|.|||..|..|.:.:|::    ...::
Mouse   261 LKKFISRRPSLKTLQEKGLIKDQ-IFGSHLHTVCER-EHSTVPWFVKQCIEAVEKR----GLDVD 319

  Fly   329 GIYRQCGDYNKIQTLRFSIDANDYDSLRQPD---VDIHTLTGVLKLFLREIKSPLVRVNEAKTFI 390
            ||||..|:...||.|||.:  |..:.|...|   .|||.:||.||:|.||:..||...:..:.|:
Mouse   320 GIYRVSGNLATIQKLRFIV--NQEEKLNLDDSQWEDIHVVTGALKMFFRELSEPLFPYSFFERFV 382

  Fly   391 GQPNQWLLTDLSAKLDSLKRLIRSLPESNRDTMDYIFGHFNRI-TKVPLQQISAETLSISVTPSI 454
            ....:   .|.:.|:::::.|::.||..|.|||..:|.|..:| .|.....:|.::|.|...|::
Mouse   383 EAIKK---QDSNEKIETMRSLVKRLPPPNHDTMKILFRHLTKIVAKASQNLMSTQSLGIVFGPTL 444

  Fly   455 FHTVPQ----GVHM 464
            .....:    .|||
Mouse   445 LRAENESGNVAVHM 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP16FNP_001285400.1 RhoGAP 306..487 CDD:238090 50/167 (30%)
Arhgap15NP_722542.2 PH 88..196 CDD:278594
PH_ARHGAP9-like 89..198 CDD:270053
RhoGAP_ARHGAP27_15_12_9 285..471 CDD:239868 56/184 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4483
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000816
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23176
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.