DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP16F and ARHGAP9

DIOPT Version :9

Sequence 1:NP_001285400.1 Gene:RhoGAP16F / 32790 FlyBaseID:FBgn0030893 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001306779.2 Gene:ARHGAP9 / 64333 HGNCID:14130 Length:750 Species:Homo sapiens


Alignment Length:523 Identity:119/523 - (22%)
Similarity:186/523 - (35%) Gaps:162/523 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RDRSTTSSSSSQAQHAYVRGHSVTSSTLFRLEGSGGSNCTLDKAGKQDTGRPEAVVLLRELKTRP 108
            |.||.|:..|.:......|.:.|.....              |..:.|||.||.:       ...
Human   247 RSRSETNPGSMEGTQTLKRNNDVLQPQA--------------KGFRSDTGTPEPL-------DPQ 290

  Fly   109 NKLALLKSSSSKDLTRL--------FLDD--STNTAVLVSNTSID---------------VCSSN 148
            ..|:|.:.:|..|...|        .|||  ....:.|::.|.|.               |.:.|
Human   291 GSLSLSQRTSQLDPPALQAPRPLPQLLDDPHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGN 355

  Fly   149 S------------SSGGSPAVGRSKSGRDRRNGLECCSSCSKRWHDLKQRMHTLE------QDLL 195
            |            |||..||..|.:|..|.|      .:.......|..|.:.|.      .:.|
Human   356 SLVFYREPPPTAPSSGWGPAGSRPESSVDLR------GAALAHGRHLSSRRNVLHIRTIPGHEFL 414

  Fly   196 VQTTYSQELE------QKVGEMSRQLTELLQERDRERDKD--------KARFAAAGGVAAPGKRT 246
            :|:.:..||.      :.|.|...:..|..:|....||:.        :.|.:.:|    |.:.:
Human   415 LQSDHETELRAWHRALRTVIERLVRWVEARREAPTGRDQGSGDRENPLELRLSGSG----PAELS 475

  Fly   247 AHGSPNVRPSRLVA--WMNLSNWFKS----------------------RPSVETLREQRIFFDEP 287
            | |......|.||:  .:.||:...|                      ||.:::|:|:.:..|: 
Human   476 A-GEDEEEESELVSKPLLRLSSRRSSIRGPEGTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQ- 538

  Fly   288 CFDTELEMVLKHDQHRTVPRIVVDCCDLIEQKYRRSTQPIEGIYRQCGDYNKIQTLRFSIDAN-- 350
            .|..:||.:.:.:.. |||..:..|...::::    ...::||||..|:...:|.|||.:|..  
Human   539 VFGCQLESLCQREGD-TVPSFLRLCIAAVDKR----GLDVDGIYRVSGNLAVVQKLRFLVDRERA 598

  Fly   351 -------------------DYDSLRQPDVDIHTLTGVLKLFLREIKSPLVRVNEAKTFIGQPNQW 396
                               |.||....  |||.:||.|||||||:..|||           |...
Human   599 VTSDGRYVFPEQPGQEGRLDLDSTEWD--DIHVVTGALKLFLRELPQPLV-----------PPLL 650

  Fly   397 L--------LTDLSAKLDSLKRLIRSLPESNRDTMDYIFGHFNR-ITKVPLQQISAETLSISVTP 452
            |        |::....|..::.||.|:|:.|.||:.|:..|..| |......:::...|.|...|
Human   651 LPHFRAALALSESEQCLSQIQELIGSMPKPNHDTLRYLLEHLCRVIAHSDKNRMTPHNLGIVFGP 715

  Fly   453 SIF 455
            ::|
Human   716 TLF 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP16FNP_001285400.1 RhoGAP 306..487 CDD:238090 49/180 (27%)
ARHGAP9NP_001306779.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..187
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..319 19/92 (21%)
Lipid binding 342..345 0/2 (0%)
Lipid binding 397..399 0/1 (0%)
Lipid binding 432..669 61/260 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 446..488 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000816
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23176
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1079
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.