DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP16F and arhgap22

DIOPT Version :9

Sequence 1:NP_001285400.1 Gene:RhoGAP16F / 32790 FlyBaseID:FBgn0030893 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_690970.4 Gene:arhgap22 / 562503 ZFINID:ZDB-GENE-090313-87 Length:698 Species:Danio rerio


Alignment Length:369 Identity:86/369 - (23%)
Similarity:146/369 - (39%) Gaps:96/369 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 SSNSSSGGSPAVGRS--KSGRDRRNGLECCSSCSKRWHDLKQRMHTLEQDLL------------- 195
            |..||...||::...  |:|     .|:...|..|.|   :.|...|..|.|             
Zfish    26 SRGSSRPSSPSLQEQVVKAG-----WLKKQRSIMKNW---QLRWFVLRTDHLYFYKDEEETKPQG 82

  Fly   196 ---VQTTYSQELEQKVGEMSRQLTELLQ----ERDRERDKDKARFAAAGGVAAPGKRTAHGSPNV 253
               :|.:...||.....|..|.|.|::.    |:||.....:|....|            .|.| 
Zfish    83 CIPLQGSQVNELTANPDEPGRHLFEIVPGCTGEKDRSALSHEAFLLMA------------NSQN- 134

  Fly   254 RPSRLVAWMNLSNWFKSRPSVETLREQRIF---FDEPCFDTELEMVLKHDQH---RTVPRIVVDC 312
                     ::.:|.|:        .:|:.   |....|...||..:::::.   |..|.:|..|
Zfish   135 ---------DMEDWVKA--------IRRVIWAPFGGGIFGQHLEDTVQYERKFGPRLAPLLVEQC 182

  Fly   313 CDLIEQKYRRSTQPIEGIYRQCGDYNKIQTLRFSIDAND---YDSLRQPDVDIHTLTGVLKLFLR 374
            .|.|.::..:.    ||::|..|..|.::.|:.:.|..|   :||    :.|:||:..:|||:||
Zfish   183 VDFIREQGLKE----EGLFRMPGQANLVKELQDAFDCGDKPLFDS----NTDVHTVASLLKLYLR 239

  Fly   375 EIKSPLVRVNEAKTFIGQPNQWLLTDLSAKLDSLKRLIRSLPESNRDTMDYIF-------GHFNR 432
            |:..|::..|:.:.|: ...|.||.|....|..|.:.:.:||::|.:.:.||.       .|.|.
Zfish   240 ELPEPVIPFNKYEDFL-TCAQLLLKDEEMGLGELVKQVSTLPQANYNLLKYICKFLDEVQSHSNE 303

  Fly   433 ITKVPLQQISAETLSISVTPSIFH-TVPQGVHMQD----IQQLL 471
                  .::|.:.|:....|:|.. .:...|.|.:    :|||:
Zfish   304 ------NKMSVQNLATVFGPNILRPKIEDPVSMMEGTTQVQQLM 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP16FNP_001285400.1 RhoGAP 306..487 CDD:238090 49/181 (27%)
arhgap22XP_690970.4 PH-like 39..154 CDD:302622 28/152 (18%)
PH 41..147 CDD:278594 27/143 (19%)
RhoGAP_ARHGAP22_24_25 154..352 CDD:239855 53/203 (26%)
BAR <577..>683 CDD:299863
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.