DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP16F and hvcn1

DIOPT Version :10

Sequence 1:NP_001285400.1 Gene:RhoGAP16F / 32790 FlyBaseID:FBgn0030893 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001011262.1 Gene:hvcn1 / 496712 XenbaseID:XB-GENE-955585 Length:230 Species:Xenopus tropicalis


Alignment Length:35 Identity:10/35 - (28%)
Similarity:15/35 - (42%) Gaps:3/35 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 ETLREQRIFFDEPCFDTELEMVLKH---DQHRTVP 306
            |:|.|:....::.|...|.|:|...   .||...|
 Frog   194 ESLLEKVAHLEQQCAQQEQEIVRLQTLLQQHNVFP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP16FNP_001285400.1 RhoGAP 306..487 CDD:238090 1/1 (100%)
hvcn1NP_001011262.1 Ion_trans 90..>174 CDD:459842
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.