DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP16F and Arhgap15

DIOPT Version :9

Sequence 1:NP_001285400.1 Gene:RhoGAP16F / 32790 FlyBaseID:FBgn0030893 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001013939.1 Gene:Arhgap15 / 295635 RGDID:1359304 Length:482 Species:Rattus norvegicus


Alignment Length:209 Identity:70/209 - (33%)
Similarity:109/209 - (52%) Gaps:19/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 LSNWFKSRPSVETLREQRIFFDEPCFDTELEMVLKHDQHRTVPRIVVDCCDLIEQKYRRSTQPIE 328
            |..:...|||::||:|:.|..|: .|.:.|..|.:. :|.|||..|..|.:.:|   :|..: ::
  Rat   262 LKKFISRRPSLKTLQEKGIIKDQ-IFGSHLHTVCER-EHSTVPWFVKQCIEAVE---KRGLE-VD 320

  Fly   329 GIYRQCGDYNKIQTLRFSIDANDYDSLRQPD---VDIHTLTGVLKLFLREIKSPLVRVNEAKTFI 390
            ||||..|:...||.|||.:  |..:.|...|   .|||.:||.||:|.||:..||...:..:.|:
  Rat   321 GIYRVSGNLATIQKLRFIV--NQEEKLNLDDSQWEDIHVVTGALKMFFRELSEPLFPYSFFERFV 383

  Fly   391 GQPNQWLLTDLSAKLDSLKRLIRSLPESNRDTMDYIFGHFNRITKVPLQQI-SAETLSISVTPSI 454
            ....:   .|..||::::|.|::|||..|.|||..:|||..:|.....|.: |.::|.|...|::
  Rat   384 EAIKK---QDSDAKIETMKSLVKSLPPPNHDTMKILFGHLTKIVAKAAQNLMSTQSLGIVFGPTL 445

  Fly   455 FHTVPQ----GVHM 464
            .....:    .|||
  Rat   446 LRAENESGNVAVHM 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP16FNP_001285400.1 RhoGAP 306..487 CDD:238090 55/167 (33%)
Arhgap15NP_001013939.1 PH 88..197 CDD:278594
PH_ARHGAP9-like 89..199 CDD:270053
RhoGAP_ARHGAP27_15_12_9 286..472 CDD:239868 61/184 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000816
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23176
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.