DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP16F and ABR

DIOPT Version :9

Sequence 1:NP_001285400.1 Gene:RhoGAP16F / 32790 FlyBaseID:FBgn0030893 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_016880028.1 Gene:ABR / 29 HGNCID:81 Length:1137 Species:Homo sapiens


Alignment Length:187 Identity:54/187 - (28%)
Similarity:89/187 - (47%) Gaps:29/187 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 FDTELEMVLKHDQHRTVPRIVVDCCDLIEQKYRRSTQPIEGIYRQCGDYNKIQTLRFSIDANDY- 352
            |..::.:|.|.::.: ||.||..|   :|:..:|..:.: ||||..|....||.|:...||:.. 
Human   904 FGVKISVVTKRERSK-VPYIVRQC---VEEVEKRGIEEV-GIYRISGVATDIQALKAVFDASKQL 963

  Fly   353 ------DSLRQ-------------PDVDIHTLTGVLKLFLREIKSPLVRVNEAKTFIGQPNQWLL 398
                  |||.|             .|:||:.:.|.|||:.||:..||:.......|:   ....|
Human   964 QKLTRADSLAQDDPTYNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFM---EGIAL 1025

  Fly   399 TDLSAKLDSLKRLIRSLPESNRDTMDYIFGHFNRIT-KVPLQQISAETLSISVTPSI 454
            :|.:||.:.:..|:||||:.|..|..::..|..|:. |.|:.::|...|:....|::
Human  1026 SDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTL 1082

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP16FNP_001285400.1 RhoGAP 306..487 CDD:238090 50/170 (29%)
ABRXP_016880028.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.