DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP16F and rga7

DIOPT Version :9

Sequence 1:NP_001285400.1 Gene:RhoGAP16F / 32790 FlyBaseID:FBgn0030893 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_595866.1 Gene:rga7 / 2540635 PomBaseID:SPBC23G7.08c Length:695 Species:Schizosaccharomyces pombe


Alignment Length:211 Identity:54/211 - (25%)
Similarity:99/211 - (46%) Gaps:27/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 FDTELEMVLKHDQHRTVPRIVVDCCDLIEQKYRRSTQPIEGIYRQCGDYNKIQTLRFSIDANDYD 353
            |...|:.::.. :|..:|.||:.|...:|    .....::||||......::..||...:.|...
pombe   504 FGARLDAIILR-EHSNIPNIVMQCTSQVE----NFGLNLQGIYRVPSSSARVNMLRSQFENNPLL 563

  Fly   354 SLRQP---DVDIHTLTGVLKLFLREIKSPLVRVNEAKTFIGQPNQWLLTDLSAKLDSLKRLIRSL 415
            .|..|   :.|:|.:..:||:|.||::.||:..|..:.||...|   :.|.|.:.|::.|.|..|
pombe   564 QLHTPEDYENDVHAVADLLKIFFRELREPLIPDNHQRDFIDAGN---VEDESRRRDAVHRAINDL 625

  Fly   416 PESNRDTMDYIFGHFNRITK-VPLQQISAETLSISVTPSIFH--TVPQGVHMQDIQQLLREGETL 477
            |::|..|:.::..|..:|.: ..:.::|...|:|...|:|..  |:|             |..:.
pombe   626 PDANYSTIRHLTIHLAKIKENSDVNKMSTNNLAIIWGPTIIKQATIP-------------EISSF 677

  Fly   478 ADCVKLMIEYQGRIFD 493
            :..::::|:|...|||
pombe   678 SRTIEILIDYCFTIFD 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP16FNP_001285400.1 RhoGAP 306..487 CDD:238090 47/186 (25%)
rga7NP_595866.1 F-BAR_Rgd1 39..277 CDD:153336
PRR18 335..>406 CDD:292299
RhoGAP_fRGD1 504..692 CDD:239863 51/208 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23176
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.