DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP16F and Arhgap9

DIOPT Version :9

Sequence 1:NP_001285400.1 Gene:RhoGAP16F / 32790 FlyBaseID:FBgn0030893 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001272714.1 Gene:Arhgap9 / 216445 MGIID:2143764 Length:648 Species:Mus musculus


Alignment Length:404 Identity:102/404 - (25%)
Similarity:155/404 - (38%) Gaps:109/404 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 SNSSSGGSPAVGRSKSGRDRRNGLECCSSCSKRWHDLKQRMHTLE------QDLLVQTTYSQELE 205
            |.|..|.:.|..|.:|..|.| |....|.     ..|..|.:.|.      .:.|:|:....||.
Mouse   279 SASLQGWARAGSRPESSVDLR-GAALASG-----RQLSSRRNVLHIRTVPGHEFLLQSDEETELR 337

  Fly   206 QKVGEMSRQLTELLQERDRERDKDKARFAAAG---------------------------GVAAPG 243
                :..|.|..:::..|||...: .|.:.:|                           |.....
Mouse   338 ----DWHRALRTVIERLDRENPLE-LRLSGSGPAELAELSAGEDDELESEPVSKSLMRLGSRRTS 397

  Fly   244 KRTAHGSP---NVRP--SRLVAWMNLSNWFKSRPSVETLREQRIFFDEPCFDTELEMVLKHDQHR 303
            .|.|.|:.   .||.  .||:|         .||::::|:|:.:|.|: .|..:||.:.:.:.. 
Mouse   398 SRCAEGTDQKNRVRNKLKRLIA---------KRPTLQSLQERGLFRDQ-VFGCQLESLCQREGD- 451

  Fly   304 TVPRIVVDCCDLIEQKYRRSTQPIEGIYRQCGDYNKIQTLRFSIDAN------------------ 350
            |||..|..|.:.:::|    ...::||||..|:...:|.|||.:|..                  
Mouse   452 TVPSFVRLCVEAVDKK----GLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYMFPEQAGQE 512

  Fly   351 ---DYDSLRQPDVDIHTLTGVLKLFLREIKSPLVRVNEAKTF-----IGQPNQWLLTDLSAKLDS 407
               |.||....  |||.:||.||||.||:..|||.......|     :.:|.|.        |..
Mouse   513 GKLDLDSAEWD--DIHVVTGALKLFFRELPQPLVPALLLPDFRDALELSEPEQC--------LSK 567

  Fly   408 LKRLIRSLPESNRDTMDYIFGHFNR-ITKVPLQQISAETLSISVTPSIFHTVPQGVHM------- 464
            :::||.|||..|.||:.||..|..| |......:::|..|.|...|::|....:...|       
Mouse   568 IQKLIDSLPRPNHDTLKYILEHLCRVIAHSDKNRMTAHNLGIVFGPTLFRPEQEASDMAAHVFYP 632

  Fly   465 -QDIQQLLREGETL 477
             |.:|.:|....:|
Mouse   633 GQLVQLMLNNFASL 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP16FNP_001285400.1 RhoGAP 306..487 CDD:238090 58/207 (28%)
Arhgap9NP_001272714.1 SH3 26..82 CDD:302595
PH_ARHGAP9-like 236..349 CDD:270053 19/79 (24%)
PH 250..348 CDD:278594 19/78 (24%)
ASCH <346..432 CDD:294653 18/95 (19%)
RhoGAP_ARHGAP27_15_12_9 438..642 CDD:239868 62/218 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000816
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23176
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1079
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.