DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and Rdh10

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_598593.1 Gene:Rdh10 / 98711 MGIID:1924238 Length:341 Species:Mus musculus


Alignment Length:248 Identity:59/248 - (23%)
Similarity:94/248 - (37%) Gaps:55/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVA-------KEL----------- 48
            :...|.|:||..|||||..|...|::.|.::|.|:.:....|.|       ::|           
Mouse    34 VAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINTQSNEETAGMVRHIYRDLEAADAAALQAG 98

  Fly    49 -GDKVVFVP---------VDVTSEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAH 103
             |::.:..|         .||...::|....:..:.:.|.:.:.||.||..:           .|
Mouse    99 KGEEEILPPCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVSVLVNNAGVVS-----------GH 152

  Fly   104 RL-----EDFQRVININTVGTFNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYS 163
            .|     |..:|.:.:|....|...:  |.|....|.|    .|.||..||........|...|.
Mouse   153 HLLECPDELIERTMMVNCHAHFWTTK--AFLPTMLEIN----HGHIVTVASSLGLFSTAGVEDYC 211

  Fly   164 ASKAAVVGMTLPIARDLST---QGIRICTIAPGLFNTPML--AALPEKVRTFL 211
            |||..|||....::.:|..   .||:...:.|.|.:|.|.  ..:.:::..||
Mouse   212 ASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 59/247 (24%)
Rdh10NP_598593.1 adh_short 37..252 CDD:278532 57/231 (25%)
17beta-HSDXI-like_SDR_c 38..307 CDD:187598 59/244 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.