DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and yohF

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_416641.1 Gene:yohF / 949126 ECOCYCID:EG12019 Length:253 Species:Escherichia coli


Alignment Length:258 Identity:68/258 - (26%)
Similarity:119/258 - (46%) Gaps:26/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKG-NEVAKEL---GDKVVFVPVDVTSEKDVS 66
            |:::|...||:|:..|..||:||..:.:......:| .:.|:|:   |.:...|.:|:.:..:.:
E. coli     4 VAIITASDSGIGKECALLLAQQGFDIGITWHSDEEGAKDTAREVVSHGVRAEIVQLDLGNLPEGA 68

  Fly    67 AALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMG 131
            .||:....:.||:|:.||.||..|.....:.      ..::::::..::..|.|...:::|..| 
E. coli    69 LALEKLIQRLGRIDVLVNNAGAMTKAPFLDM------AFDEWRKIFTVDVDGAFLCSQIAARQM- 126

  Fly   132 ANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLFN 196
                .:.||.|.|:|..||.........:||:|:|.|:.|:|..:|.:|....|.:..:|||...
E. coli   127 ----VKQGQGGRIINITSVHEHTPLPDASAYTAAKHALGGLTKAMALELVRHKILVNAVAPGAIA 187

  Fly   197 TPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLV------QAIYENPLLNGEVIRIDGALRM 253
            |||.......|:.....|||. :|.|...|.|.||      .|.|    ..|:.:.:||...:
E. coli   188 TPMNGMDDSDVKPDAEPSIPL-RRFGATHEIASLVVWLCSEGANY----TTGQSLIVDGGFML 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 68/258 (26%)
yohFNP_416641.1 PRK12743 1..253 CDD:237187 68/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
21.910

Return to query results.
Submit another query.