DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and ygfF

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_417378.1 Gene:ygfF / 947373 ECOCYCID:G7514 Length:247 Species:Escherichia coli


Alignment Length:239 Identity:79/239 - (33%)
Similarity:117/239 - (48%) Gaps:27/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVSLVTGGASGLGRATAERLAKQGASVIL---ADLPSSKGNEVAK---ELGDKVVFVPVDVTSEK 63
            |::|||||:.|:|||||..||::|.:|.:   .:|.:::  ||..   :.|.|...:..|::.|.
E. coli     2 AIALVTGGSRGIGRATALLLAQEGYTVAVNYQQNLHAAQ--EVMNLITQAGGKAFVLQADISDEN 64

  Fly    64 DVSAALQTAKDKFGR-LDLTVNCAG---TATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIR 124
            .| .|:.||.|:... |...||.||   |...|:...        .|...||::.|..|.|...|
E. coli    65 QV-VAMFTAIDQHDEPLAALVNNAGILFTQCTVENLT--------AERINRVLSTNVTGYFLCCR 120

  Fly   125 LSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQ-AAYSASKAAVVGMTLPIARDLSTQGIRIC 188
            .:...|..   ...|..|.|||.:|||:..|..|: ..|:|||.|:..:|..::.:::.||||:.
E. coli   121 EAVKRMAL---KNGGSGGAIVNVSSVASRLGSPGEYVDYAASKGAIDTLTTGLSLEVAAQGIRVN 182

  Fly   189 TIAPGLFNTPMLAALPEKVRTFLAKS-IPFPQRLGEPSEYAHLV 231
            .:.||...|.|.|:..|..|....|| ||. ||.|:..|.|..:
E. coli   183 CVRPGFIYTEMHASGGEPGRVDRVKSNIPM-QRGGQAEEVAQAI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 79/239 (33%)
ygfFNP_417378.1 PRK09730 1..247 CDD:182051 79/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
21.910

Return to query results.
Submit another query.