DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and ygcW

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_417254.4 Gene:ygcW / 947232 ECOCYCID:G7440 Length:261 Species:Escherichia coli


Alignment Length:255 Identity:74/255 - (29%)
Similarity:124/255 - (48%) Gaps:21/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKG--NEVAKELGDKVVFVPVDVTSEKD 64
            :|...::||||.||||:|.|..|||.||::.:.......|  .|:.::.|.:|.|:.|.:|:|..
E. coli    16 LKGKTAIVTGGNSGLGQAFAMALAKAGANIFIPSFVKDNGETKEMIEKQGVEVDFMQVGITAEGA 80

  Fly    65 VSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGL 129
            ....:....::||.:|:.||.||.....|..:|.:      .|:..:|::|....|.:...:|.:
E. coli    81 PQKIIAACCERFGTVDILVNNAGICKLNKVLDFGR------ADWDPMIDVNLTAAFELSYEAAKI 139

  Fly   130 MGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGL 194
            |   .|.:.|:   |:|..|:.::.|.....||||:|.|:.|.|.....:|....|::..||||.
E. coli   140 M---IPQKSGK---IINICSLFSYLGGQWSPAYSATKHALAGFTKAYCDELGQYNIQVNGIAPGY 198

  Fly   195 FNTPMLAAL---PEKVRTFLAKSIPFPQRLGEPSEY--AHLVQAIYENPLLNGEVIRIDG 249
            :.|.:..|.   ||..:..| ..|| ..|.|:..:.  |.:..|...:..:||.::.:||
E. coli   199 YATDITLATRSNPETNQRVL-DHIP-ANRWGDTQDLMGAAVFLASPASNYVNGHLLVVDG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 74/254 (29%)
ygcWNP_417254.4 Ga5DH-like_SDR_c 14..260 CDD:187605 74/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.