DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and hdhA

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_416136.1 Gene:hdhA / 946151 ECOCYCID:EG10425 Length:255 Species:Escherichia coli


Alignment Length:251 Identity:75/251 - (29%)
Similarity:128/251 - (50%) Gaps:24/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKE---LGDKVVFVPVDVTSEKDVSAA 68
            :::||..:|:|:..|...|..||||:::|:.:...|.|..|   ||.:......|:|||:::||.
E. coli    14 AIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSAL 78

  Fly    69 LQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMGAN 133
            ...|..|.|::|:.||.|| ....|.|:.      .:.||:|...:|....|::.:|.|..|..|
E. coli    79 ADFAISKLGKVDILVNNAG-GGGPKPFDM------PMADFRRAYELNVFSFFHLSQLVAPEMEKN 136

  Fly   134 EPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNTP 198
                  ..|||:...|:||.:..|...:|::||||...:...:|.||..:.||:..||||...|.
E. coli   137 ------GGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTD 195

  Fly   199 MLAAL--PEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIYENPL---LNGEVIRIDG 249
            .|.::  || :...:.:..|. :|||:|.:.|:....:. :|.   ::|:::.:.|
E. coli   196 ALKSVITPE-IEQKMLQHTPI-RRLGQPQDIANAALFLC-SPAASWVSGQILTVSG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 75/251 (30%)
hdhANP_416136.1 PRK06113 1..255 CDD:135765 75/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
21.910

Return to query results.
Submit another query.