DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and ydfG

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_416057.1 Gene:ydfG / 946085 ECOCYCID:EG12345 Length:248 Species:Escherichia coli


Alignment Length:191 Identity:57/191 - (29%)
Similarity:86/191 - (45%) Gaps:15/191 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVSAALQ 70
            :.||||..:|.|.....|..:||..||.......:..|:..||||.:....:||.:...:...|.
E. coli     2 IVLVTGATAGFGECITRRFIQQGHKVIATGRRQERLQELKDELGDNLYIAQLDVRNRAAIEEMLA 66

  Fly    71 TAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHR--LEDFQRVININTVGTFNVIRLSAGLMGAN 133
            :...::..:|:.||.||.|..::.       ||:  :||::.:|:.|..|...:.|  |.|.|..
E. coli    67 SLPAEWCNIDILVNNAGLALGMEP-------AHKASVEDWETMIDTNNKGLVYMTR--AVLPGMV 122

  Fly   134 EPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGL 194
            |.|    .|.|:|..|.|......|...|.|:||.|...:|.:..||....:|:..|.|||
E. coli   123 ERN----HGHIINIGSTAGSWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 57/191 (30%)
ydfGNP_416057.1 PRK10538 1..248 CDD:182531 57/191 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.