DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and SPS19

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_014197.2 Gene:SPS19 / 855518 SGDID:S000005146 Length:292 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:78/266 - (29%)
Similarity:126/266 - (47%) Gaps:33/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKNAVSLVTGGASGLGRATAERLAKQG--ASVILADL----PSSKG-NEVAKELGDKVVFVPVD 58
            :.|..|:.|||||..:.|...|.|...|  |:::..|.    .::|| :::||:....:....||
Yeast    21 LFKGKVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIANVD 85

  Fly    59 VTSEKDVSAALQTAKDKFGRLDLTVNCAGTA-TAVKTF-NFNKNVAHRLEDFQRVININTVGTFN 121
            |.:.:.|..|::...:|||::|..:  ||.| ..|..| |.:.|.      |:.|::|:.:|:||
Yeast    86 VRNFEQVENAVKKTVEKFGKIDFVI--AGAAGNFVCDFANLSPNA------FKSVVDIDLLGSFN 142

  Fly   122 VIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIR 186
            ..:  |.|....:     .:|.|:..::...:.|...|....|:||.:..:...:|.:|...|||
Yeast   143 TAK--ACLKELKK-----SKGSILFVSATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIR 200

  Fly   187 ICTIAPG-LFNTPMLAALPEK--VRTFLAKSIPFPQRLGEPSEYAHLVQAIYENP---LLNGEVI 245
            ...|||| :.||..|..|..|  ....||| ||. ||||...:.|.....|: :|   .:.|.|:
Yeast   201 SNCIAPGAIDNTEGLKRLAGKKYKEKALAK-IPL-QRLGSTRDIAESTVYIF-SPAASYVTGTVL 262

  Fly   246 RIDGAL 251
            .:||.:
Yeast   263 VVDGGM 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 78/264 (30%)
SPS19NP_014197.2 TER_DECR_SDR_a 22..270 CDD:187627 78/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.