DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and IRC24

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_012302.3 Gene:IRC24 / 854854 SGDID:S000001475 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:265 Identity:62/265 - (23%)
Similarity:115/265 - (43%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKG--NEVAKELG-DKVVFVPVDVTSEKDVSA 67
            |.|:||.:.|:|....:.:.::....|:..:..::.  ..:.:|.| ||.|:..:|:|....:.|
Yeast     4 VILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITDRSRMEA 68

  Fly    68 ALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMGA 132
            .::..:.|.|:||..|..||....||:.: ..|..|.::.::|:.::|.....:::.|...|:.:
Yeast    69 LVEEIRQKHGKLDGIVANAGMLEPVKSIS-QSNSEHDIKQWERLFDVNFFSIVSLVALCLPLLKS 132

  Fly   133 NEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNT 197
            :.     ..|.||..:|.|:.....|.:||..||||:....:.||.:..:..:|...||||:.:|
Yeast   133 SP-----FVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDT 192

  Fly   198 PMLAALPE-------------------KVRTFLAKSIPFPQRLGEPSEYAHLVQAIYEN--PLLN 241
            .|...:.|                   |..:.|...:|          .|.|.|.:.:.  ..||
Yeast   193 QMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVP----------AAVLAQLVLKGIPDSLN 247

  Fly   242 GEVIR 246
            |:.:|
Yeast   248 GQYLR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 62/265 (23%)
IRC24NP_012302.3 SPR-like_SDR_c 4..255 CDD:187625 62/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.