DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and NRE1

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_012301.3 Gene:NRE1 / 854853 SGDID:S000001474 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:47/205 - (22%)
Similarity:90/205 - (43%) Gaps:18/205 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKG--NEVAKELGDKVVFVPVDVTSEKDVSAA 68
            |.||||.:.|:|::..:.|.......::..:..|:.  .::.::.||:..:|..|:|.:..:...
Yeast     4 VILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDITEDSVLKQL 68

  Fly    69 LQTAKDKFGRLDLTVNCAGTATAVKTFN-FNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMGA 132
            :..|....|::|..|..||....|:..| .:.|...:|.|         :..|:::    .|:|.
Yeast    69 VNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYD---------INFFSIV----SLVGI 120

  Fly   133 NEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNT 197
            ..|......|.:|..:|.|.........||.:||||:....:.:|.:  .:.::...:|||:.:|
Yeast   121 ALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKAIAVAPGIVDT 183

  Fly   198 PMLAALPEKV 207
            .|...:.|.|
Yeast   184 DMQVNIRENV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 47/205 (23%)
NRE1NP_012301.3 SPR-like_SDR_c 4..246 CDD:187625 47/205 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.