DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AYR1

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_012142.3 Gene:AYR1 / 854682 SGDID:S000001386 Length:297 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:58/226 - (25%)
Similarity:93/226 - (41%) Gaps:46/226 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVI--------LADLPSSKGNEVAKELGDKVVFVPVDVTSE 62
            :::|||.:.|:|....:.||:.|..|.        :|.|....||       |.:....:|::..
Yeast    11 IAVVTGASGGIGYEVTKELARNGYLVYACARRLEPMAQLAIQFGN-------DSIKPYKLDISKP 68

  Fly    63 KDV---SAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIR 124
            :::   |..|: |....|:|||..|.||.:......:......      ::...:|..|..|:.|
Yeast    69 EEIVTFSGFLR-ANLPDGKLDLLYNNAGQSCTFPALDATDAAV------EQCFKVNVFGHINMCR 126

  Fly   125 -LSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRIC 188
             ||..|:.|        :|.||.|.|:|........:.|||||||:    ...||.|..:     
Yeast   127 ELSEFLIKA--------KGTIVFTGSLAGVVSFPFGSIYSASKAAI----HQYARGLHLE----- 174

  Fly   189 TIAPGLFNTPMLAALPEKVRTFLAKSIPFPQ 219
             :.|  ||..::.|:...|.|.:|...|.|:
Yeast   175 -MKP--FNVRVINAITGGVATDIADKRPLPE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 58/226 (26%)
AYR1NP_012142.3 17beta-HSD-like_SDR_c 10..256 CDD:187632 58/226 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.