DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and ENV9

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_014889.3 Gene:ENV9 / 854420 SGDID:S000005772 Length:330 Species:Saccharomyces cerevisiae


Alignment Length:250 Identity:49/250 - (19%)
Similarity:91/250 - (36%) Gaps:73/250 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL------------------ 48
            ::..:::||||.:|:|..|...|...|..|.:....|.|.::..:|:                  
Yeast    14 VERKIAVVTGGNTGIGWYTVLHLYLHGFVVYICGRNSHKISKAIQEILAEAKKRCHEDDDGSSPG 78

  Fly    49 ---GDKVV------FVPVDVTSEKDVS-AALQTAKDKFGRLDLTVNCAGTATA------------ 91
               |..:.      ::.:|:|..|.|. |||:..|.: ..:|:.||.||....            
Yeast    79 AGPGPSIQRLGSLHYIHLDLTDLKCVERAALKILKLE-DHIDVLVNNAGIMAVPLEMTKDGFEVQ 142

  Fly    92 -----VKTFNFNKNVAHRLEDFQ-RVININTVG---TFNVIRLSAGLMGANEPNQDGQRGVIVNT 147
                 :..|.|...:...|...: |:|:::::|   .|...:||.  ....:||.          
Yeast   143 LQTNYISHFIFTMRLLPLLRHCRGRIISLSSIGHHLEFMYWKLSK--TWDYKPNM---------- 195

  Fly   148 ASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGL-FNTPMLA 201
                    ......|:.||.|::..|..:|  :....:...::.||| .||.:.:
Yeast   196 --------LFTWFRYAMSKTALIQCTKMLA--IKYPDVLCLSVHPGLVMNTNLFS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 49/248 (20%)
ENV9NP_014889.3 NADB_Rossmann 17..318 CDD:419666 49/246 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.