DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and FOX2

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_012934.1 Gene:FOX2 / 853878 SGDID:S000001717 Length:900 Species:Saccharomyces cerevisiae


Alignment Length:261 Identity:77/261 - (29%)
Similarity:123/261 - (47%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NAVSLVTGGASGLGRATAERLAKQGASVILADL--PSSKGNEVAKELGDKVVFVP--VDVTSEKD 64
            |.|.:|||...|||::.|...|:.||.|::.|:  |.|...|:.|..|:... :|  .||.:|..
Yeast   322 NKVVVVTGAGGGLGKSHAIWFARYGAKVVVNDIKDPFSVVEEINKLYGEGTA-IPDSHDVVTEAP 385

  Fly    65 VSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGL 129
            :  .:|||..||.|:|:.||.||.... |:|...|:     |::..|:.::...||:       |
Yeast   386 L--IIQTAISKFQRVDILVNNAGILRD-KSFLKMKD-----EEWFAVLKVHLFSTFS-------L 435

  Fly   130 MGANEPNQDGQR-GVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPG 193
            ..|..|....|: |.|:||.|.:...|..|||.|:|:|||::|.:..||.:.:.:||.:..||| 
Yeast   436 SKAVWPIFTKQKSGFIINTTSTSGIYGNFGQANYAAAKAAILGFSKTIALEGAKRGIIVNVIAP- 499

  Fly   194 LFNTPMLAALPEKVRTFLAKSIPFPQRLG---EPSEYAHLVQAI-------YENPLLNGEVIRID 248
                        ...|.:.|:|...:.|.   :.|:.:.||..:       |....:.|::..:.
Yeast   500 ------------HAETAMTKTIFSEKELSNHFDASQVSPLVVLLASEELQKYSGRRVIGQLFEVG 552

  Fly   249 G 249
            |
Yeast   553 G 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 77/261 (30%)
FOX2NP_012934.1 hydroxyacyl-CoA-like_DH_SDR_c-like 5..255 CDD:187611
NADB_Rossmann 336..566 CDD:419666 69/247 (28%)
PLN02864 613..886 CDD:178455
HDE_HSD 782..894 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.