DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and YKL107W

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_012815.1 Gene:YKL107W / 853753 SGDID:S000001590 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:269 Identity:56/269 - (20%)
Similarity:100/269 - (37%) Gaps:76/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKE-LGDKVVFVPVDVT--SE-KDVSAAL 69
            :.||..|||||.:..||::.|.|.:.      |.....| |.||:.||..|::  || |.:|.:.
Yeast    28 IIGGTGGLGRAISRELAQRNARVTVV------GQTFRDEDLKDKINFVKADLSLVSECKRISHSD 86

  Fly    70 QTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMGANE 134
            :...::...|..|.....:.....|          .|..::.:.::.:..:.:....|..:|.:.
Yeast    87 EIPYEELTHLIFTTGIFASRQRQAT----------SEGLEKDMAVSYLSRYIIFHDVAKRLGISR 141

  Fly   135 PNQDGQRGVIVNTASVAAF--DGQIGQ-----------AAY-------SASKAAVVGMTLPIARD 179
            ..:|....|.     :|.|  :||:|.           :||       :|:::.|:.     |:|
Yeast   142 TKKDDLPKVF-----IAGFPGNGQVGDPDDLNSDEKKYSAYATHMNTVAANESLVID-----AKD 196

  Fly   180 ----LSTQGIRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGE---------PSEYAHLV 231
                :.|.|:.     |||..|        .:|..|..|..:..|:.|         ...||..:
Yeast   197 RYTNIDTFGLN-----PGLIKT--------NIRNNLLGSDTYLSRITEWIISWTCQSAETYAKTI 248

  Fly   232 QAIYENPLL 240
            ..:..:|.:
Yeast   249 CTLIASPAI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 56/269 (21%)
YKL107WNP_012815.1 NADB_Rossmann 26..285 CDD:419666 56/269 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.