DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and IFA38

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_009717.1 Gene:IFA38 / 852456 SGDID:S000000363 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:62/256 - (24%)
Similarity:115/256 - (44%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDK----VVFVPVDVTSEKDVSAAL 69
            :||.:.|:|:..|.::||:|.:::|.....||...:.|||.|:    |..:.:|:..:|:  :..
Yeast    67 ITGASDGIGKEFARQMAKRGFNLVLISRTQSKLEALQKELEDQHHVVVKILAIDIAEDKE--SNY 129

  Fly    70 QTAKDKFGRLDLT--VNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMGA 132
            ::.|:...:|.:|  ||..|.:.::..    ..:....::.:.:|.||...|..:.::.|..:..
Yeast   130 ESIKELCAQLPITVLVNNVGQSHSIPV----PFLETEEKELRNIITINNTATLLITQIIAPKIVE 190

  Fly   133 N---EPNQDGQRGVIVNTASVAAFDGQIGQ---AAYSASKAAVVGMTLPIARDLSTQGIRICTIA 191
            .   |..:.|.||:|:   ::.:|.|.|..   |.||.||:.:.|.:..:|.:||...|.:..|.
Yeast   191 TVKAENKKSGTRGLIL---TMGSFGGLIPTPLLATYSGSKSFLQGWSNSLAGELSKDAIDVELII 252

  Fly   192 PGLFNTPMLAALPEKVRTFLAKSIPFPQ------------RLGEPSEYA----HLVQAIYE 236
            ..|..:.|     .|:|. .:..||.||            |.|....||    :...|:|:
Yeast   253 SYLVTSSM-----SKIRR-SSLMIPNPQQFVKSTLRSVGRRCGSQERYATMTPYWAHAVYQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 62/256 (24%)
IFA38NP_009717.1 17beta-HSD1_like_SDR_c 62..310 CDD:187614 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.