DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and YDL114W

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_010169.1 Gene:YDL114W / 851444 SGDID:S000002272 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:253 Identity:72/253 - (28%)
Similarity:123/253 - (48%) Gaps:46/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVSA 67
            |||.:|:|||:||||...|:.|:::...||:||:.|..  ..|:...:.:.:...|:||..::..
Yeast    37 KNATALITGGSSGLGFELAKELSRRINKVIVADIQSFP--TFAQVEYNNIFYYQCDITSLDEIKN 99

  Fly    68 ALQTAKDKFGRLDLTVNCAGTATAVKTFNF-NKNVAHRLEDFQRVININTVGTFNVIRLSAGLMG 131
            ..:..:...|.:::.:|.||.|...|..:. ||.|       :::|:||.:|.:.:|...|    
Yeast   100 LKKAIERDHGNINIIINNAGVAHIKKLEHMTNKEV-------EQLIDINLIGAYRIISTFA---- 153

  Fly   132 ANEPNQDGQRGVIVNTASVAAFDGQIGQA---AYSASKAAVVGMTLPIA---RDLSTQ----GIR 186
              |...|.:.|.|:|.|||.   |::..|   :|.|||.|::|....::   |.|||:    ||:
Yeast   154 --EDMIDNREGFIINIASVL---GELTPARLTSYGASKGAMIGFHKCMSRHFRSLSTECNKTGIK 213

  Fly   187 ICTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGE----PSEYA-HLVQAIYENPL 239
            ...:.||            |::|.:...:|.|.:|..    ||:.| .::.|:..|.|
Yeast   214 TLLVCPG------------KIKTNMFIDVPTPSKLLAPDIIPSQLALAIISAMEHNHL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 72/253 (28%)
YDL114WNP_010169.1 17beta-HSDXI-like_SDR_c 40..282 CDD:187598 69/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.913288 Normalized mean entropy S1300
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.