DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and TDA5

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_013530.1 Gene:TDA5 / 851146 SGDID:S000004418 Length:326 Species:Saccharomyces cerevisiae


Alignment Length:274 Identity:76/274 - (27%)
Similarity:121/274 - (44%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNAVSLVTGGASGLGRATAERLAKQGASVILADL---PSSKGNEVAKELGDKVVFVPVDVTSEKD 64
            ||.:.|:|||:.|||||...:|.:..:::.:.::   |||..|...|:|       ..|::.:::
Yeast    69 KNGIVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVRNTRVKDL-------ICDLSDDEE 126

  Fly    65 VSAALQTAKDKF-GRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAG 128
            |:|.|...|.|: ..:.|.||.||.......||     ....::..::..|||......|:..| 
Yeast   127 VAALLNLLKRKYKNEIRLIVNNAGVRANFTGFN-----GMERDNLDKIFKINTFAPLQFIQELA- 185

  Fly   129 LMGANEPNQDGQRG-VIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQG---IRICT 189
                  |::...|. .|||.||:.........|||:|||||::......:.:|..:|   ||...
Yeast   186 ------PSRHSTRQCYIVNIASILGILTPAKVAAYAASKAALIAFHQSYSFELQNEGVRNIRTLL 244

  Fly   190 IAPGLFNTPMLAAL--PEK-------VRTFLAKSIPFPQ-----RLGEP--SEYAHLVQAI-YEN 237
            :.||..||.|.|..  |.:       :.|..||.:.:.:     :|.||  ..:|||:..: |..
Yeast   245 VTPGQLNTEMFAGFKPPRQFFAPVIDITTLAAKIVRYCELGQRGQLNEPFYCSFAHLLMCVPYSL 309

  Fly   238 PLLNGEVIRIDGAL 251
            ..:.....|||..|
Yeast   310 QRIVRSFSRIDCCL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 76/274 (28%)
TDA5NP_013530.1 NADB_Rossmann 72..309 CDD:419666 70/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.