DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and ABA2

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_175644.1 Gene:ABA2 / 841665 AraportID:AT1G52340 Length:285 Species:Arabidopsis thaliana


Alignment Length:214 Identity:70/214 - (32%)
Similarity:108/214 - (50%) Gaps:24/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL-----GDKVVFVPVDVTSEKDV 65
            |:|:||||:|:|.:......|.||.|.:.||....|.||.|.|     .:...|:..||..|.|:
plant    22 VALITGGATGIGESIVRLFHKHGAKVCIVDLQDDLGGEVCKSLLRGESKETAFFIHGDVRVEDDI 86

  Fly    66 SAALQTAKDKFGRLDLTVNCAGTATA----VKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLS 126
            |.|:..|...||.||:.:|.||...|    ::.::        |.:|:...::|..|.|..::.:
plant    87 SNAVDFAVKNFGTLDILINNAGLCGAPCPDIRNYS--------LSEFEMTFDVNVKGAFLSMKHA 143

  Fly   127 AGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIA 191
            |.:|...      ::|.||:..||....|.:|..:|..||.||:|:|..:|.:|...|||:..::
plant   144 ARVMIPE------KKGSIVSLCSVGGVVGGVGPHSYVGSKHAVLGLTRSVAAELGQHGIRVNCVS 202

  Fly   192 PGLFNTPM-LAALPEKVRT 209
            |....|.: ||.|||:.||
plant   203 PYAVATKLALAHLPEEERT 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 70/214 (33%)
ABA2NP_175644.1 PLN02253 3..285 CDD:177895 70/214 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.