DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and NQR

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001185182.1 Gene:NQR / 841391 AraportID:AT1G49670 Length:652 Species:Arabidopsis thaliana


Alignment Length:219 Identity:71/219 - (32%)
Similarity:105/219 - (47%) Gaps:22/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVS-LVTGGASGLGRATAERLAKQGASVILADLPSSKGNE---VAKELGDK---------VV 53
            ||..:| ||||||||:|||....||::|..|.:||....||.|   :.:|...|         .:
plant     3 IKPGLSALVTGGASGIGRALCLALAEKGVFVTVADFSEEKGQETTSLVREANAKFHQGLSFPSAI 67

  Fly    54 FVPVDVTSEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVG 118
            ||..|||:..|:.||.......||.||:.:|.||.:|.::   |:|:.....:.::..||::.:.
plant    68 FVKCDVTNRGDLLAAFDKHLATFGTLDICINNAGISTPLR---FDKDDTDGSKSWKHTINVDLIA 129

  Fly   119 TFNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQ 183
            .....:|:...|.|.:     :.|||:|..|.|..........|:||||.||..|..:|. ...|
plant   130 VVEGTQLAIKAMKAKQ-----KPGVIINMGSAAGLYPMPVDPIYAASKAGVVLFTRSLAY-YRRQ 188

  Fly   184 GIRICTIAPGLFNTPMLAALPEKV 207
            ||||..:.|....|.:..|:...:
plant   189 GIRINVLCPEFIKTDLAEAIDASI 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 70/218 (32%)
NQRNP_001185182.1 ADH_SDR_c_like 9..254 CDD:187584 68/213 (32%)
adh_short 9..210 CDD:278532 68/209 (33%)
CurA 285..639 CDD:225041
Mgc45594_like 286..640 CDD:176212
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.