DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and NOL

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_568145.1 Gene:NOL / 830372 AraportID:AT5G04900 Length:348 Species:Arabidopsis thaliana


Alignment Length:261 Identity:67/261 - (25%)
Similarity:112/261 - (42%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTGGASGLGRATAERLAKQGASVIL----ADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVSAA 68
            |:||...|:|.|.|....|.|.:|::    |:...:....:.:|.|:.|.....|||..|||...
plant    83 LITGSTKGIGYALAREFLKAGDNVVICSRSAERVETAVQSLKEEFGEHVWGTKCDVTEGKDVREL 147

  Fly    69 LQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLM--- 130
            :..::.....:|:.:|.||:    ..::|........||...|:..||:|.....|.:..:|   
plant   148 VAYSQKNLKYIDIWINNAGS----NAYSFKPLAEASDEDLIEVVKTNTLGLMLCCREAMNMMLTQ 208

  Fly   131 --GANEPNQDGQRGVIVNTASVAAFDGQIGQ--AAYSASKAAVVGMTLPIARDLSTQGIR---IC 188
              |.:..|.||           |..||:...  |||.|:|.:||.:|..:..:|..|.::   :.
plant   209 SRGGHIFNIDG-----------AGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVH 262

  Fly   189 TIAPGLFNTPML--AALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIYENPLLNGEVIRIDGAL 251
            .::||:..|.:|  .|..::.:.|:       ..|.||:|    |.|.|..|  |...|...|::
plant   263 NLSPGMVTTDLLMSGATTKQAKFFI-------NVLAEPAE----VVAEYLVP--NIRAIPASGSM 314

  Fly   252 R 252
            :
plant   315 K 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 67/261 (26%)
NOLNP_568145.1 adh_short 81..276 CDD:278532 54/207 (26%)
SDR_c 82..302 CDD:212491 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.