DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AT4G13180

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_193054.1 Gene:AT4G13180 / 826932 AraportID:AT4G13180 Length:263 Species:Arabidopsis thaliana


Alignment Length:256 Identity:75/256 - (29%)
Similarity:118/256 - (46%) Gaps:25/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADL-PSSKGNEVAKELGD-----KVVFVPVDVTSEKD 64
            |::|||...|:||..|..|...||.|.:..: .|||...:..||.|     ..:.|..||:....
plant    17 VAIVTGATRGMGREIAIHLHSLGARVTINYVSSSSKAELLVSELNDSSQLKSAIAVKADVSDPDQ 81

  Fly    65 VSAALQTAKDKFG-RLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAG 128
            ::......:.:|| ::.:.|||||.... |..:.::..   ||||.....|||.|:|...:.:|.
plant    82 INNLFDQTEQEFGSKVHIVVNCAGVLDP-KYPSLSETT---LEDFDNTFTINTRGSFLCCKEAAK 142

  Fly   129 --LMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIA 191
              :.|.      |.|.::::|:.|...  ..|...|:||||||..|...:|::|....|....:|
plant   143 RVMRGG------GGRIIMMSTSMVGGL--APGYGVYAASKAAVETMVKVLAKELKGSRITANCVA 199

  Fly   192 PGLFNTPML-AALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIYEN--PLLNGEVIRIDG 249
            ||...|.|. |...::....||.:.|. .|:||..:...:|..:..:  ..:||:|||.:|
plant   200 PGPVATEMFYAGKSDETVKMLAGACPM-GRIGESKDITEIVGFLAGDGGEWINGQVIRANG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 75/256 (29%)
AT4G13180NP_193054.1 THN_reductase-like_SDR_c 13..262 CDD:187620 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.