DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and HSD5

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_192740.1 Gene:HSD5 / 826593 AraportID:AT4G10020 Length:389 Species:Arabidopsis thaliana


Alignment Length:247 Identity:67/247 - (27%)
Similarity:109/247 - (44%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEV---AKELG-DKVVFVPVDVTSE 62
            :::.|.::||.:|.:|...|...||:||:::|......:...|   ||::| :.|:.:..||..|
plant    47 MEDKVVVITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNKAKQIGANHVIIIAADVIKE 111

  Fly    63 KDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLED---FQRVININTVGTFNVIR 124
            .|....:..|.:.:||:|..||   ||:...||.|.:     :.|   |..:::||..|  ||..
plant   112 DDCRRFITQAVNYYGRVDHLVN---TASLGHTFYFEE-----VSDTTVFPHLLDINFWG--NVYP 166

  Fly   125 LSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQ-GIRIC 188
            ....|...::.|     |.||..|||..:......:.|||:|||:|.....:..:|:.. ||.|.
plant   167 TYVALPYLHQTN-----GRIVVNASVENWLPLPRMSLYSAAKAALVNFYETLRFELNGDVGITIA 226

  Fly   189 T-------IAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQA 233
            |       ::.|.|      .|.|.......:....|...|...|:|.::.|
plant   227 THGWIGSEMSGGKF------MLEEGAEMQWKEEREVPANGGPLEEFAKMIVA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 67/246 (27%)
HSD5NP_192740.1 NADB_Rossmann 47..303 CDD:419666 67/247 (27%)
Extensin_2 343..>379 CDD:252669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.