DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AT4G09750

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_192713.1 Gene:AT4G09750 / 826563 AraportID:AT4G09750 Length:322 Species:Arabidopsis thaliana


Alignment Length:229 Identity:57/229 - (24%)
Similarity:97/229 - (42%) Gaps:33/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL----GDKVVFVPV-DVTSE 62
            ||.|  |||..||:|.|.||.||.:||:|.:......:|.|...::    |::.|::.| |::|.
plant    44 KNCV--VTGANSGIGFAAAEGLASRGATVYMVCRNKERGQEALSKIQTSTGNQNVYLEVCDLSSV 106

  Fly    63 KDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSA 127
            .::.:...:...|...:.:.||.||.....:|..        .|.|:....:|.:||:.:..|..
plant   107 NEIKSFASSFASKDVPVHVLVNNAGLLENKRTTT--------PEGFELSFAVNVLGTYTMTELML 163

  Fly   128 GLMGANEPNQDGQRGVIVNTASVAAFDGQI------------GQAAYSASKAAVVGMTLPIARDL 180
            .|:....|:     ..::..||...:...:            |...|:.:|...|.:|...|...
plant   164 PLLEKATPD-----AKVITVASGGMYTSPLTTDLQFSGEKFDGVEQYARNKRIQVALTEKWADKY 223

  Fly   181 STQGIRICTIAPGLFNTPMLA-ALPEKVRTFLAK 213
            ..:||...::.||...||.:| :||....:|..|
plant   224 KNKGIGFYSMHPGWAETPGVAKSLPSFSESFAGK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 57/229 (25%)
AT4G09750NP_192713.1 FabG 41..283 CDD:223959 57/229 (25%)
NADB_Rossmann 43..298 CDD:304358 57/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.