DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and IBR1

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_567300.1 Gene:IBR1 / 825905 AraportID:AT4G05530 Length:254 Species:Arabidopsis thaliana


Alignment Length:265 Identity:57/265 - (21%)
Similarity:112/265 - (42%) Gaps:38/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDKVV---FVPVDVTSEK 63
            ::..|::||....|:|....||...:||||:::....:..:|...:|..|.:   .:...|::.:
plant     9 LEGKVAIVTASTQGIGFGITERFGLEGASVVVSSRKQANVDEAVAKLKSKGIDAYGIVCHVSNAQ 73

  Fly    64 DVSAALQTAKDKFGRLDLTV-NCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSA 127
            .....::....|:|::|:.| |.|...:.....:..:.|..:|.:    ||:.:         |.
plant    74 HRRNLVEKTVQKYGKIDIVVCNAAANPSTDPILSSKEAVLDKLWE----INVKS---------SI 125

  Fly   128 GLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAP 192
            .|:....|:.:....||..| |:|.|..|...|.|..:|.|::|:|..:|.:::.. .|:..:||
plant   126 LLLQDMAPHLEKGSSVIFIT-SIAGFSPQGAMAMYGVTKTALLGLTKALAAEMAPD-TRVNAVAP 188

  Fly   193 GLFNTPMLAALPEKVRTFLAKSIPFPQ---------RLGEPSEYAHLVQ--AIYENPLLNGEVIR 246
            |.        :|....:|:..|....:         |||...:.|....  |..::..:.||.:.
plant   189 GF--------VPTHFASFITGSSEVREGIEEKTLLNRLGTTGDMAAAAAFLASDDSSYITGETLV 245

  Fly   247 IDGAL 251
            :.|.:
plant   246 VAGGM 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 57/264 (22%)
IBR1NP_567300.1 NADB_Rossmann 6..254 CDD:389744 57/265 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.