DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AT3G55290

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_567019.1 Gene:AT3G55290 / 824695 AraportID:AT3G55290 Length:280 Species:Arabidopsis thaliana


Alignment Length:226 Identity:67/226 - (29%)
Similarity:114/226 - (50%) Gaps:22/226 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL------GDKVVFVPVDVT 60
            :|:.|.||||.:||:||.....|||.|..||.|.....:.|.:..|:      |.:...:.:||:
plant    18 LKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSFSSTGIQAAALELDVS 82

  Fly    61 SE-KDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIR 124
            |: ..:..|::.|.|.||::|..:|.||....||:     ::....:::..|...|..|.:.|.:
plant    83 SDAATIQKAVREAWDIFGKIDALINNAGIRGNVKS-----SLDLSEDEWDNVFKTNLKGPWLVSK 142

  Fly   125 LSAGLMGANEPNQDGQR-GVIVNTASVAAFDGQI-GQAAYSASKAAVVGMTLPIARDLSTQGIRI 187
            ....||      :|.:| |.::|.:|:|...|.: |..||:.||..|..|:..:|.:|....||:
plant   143 HVCMLM------RDAKRGGSVINISSIAGIRGMLPGGLAYACSKGGVDTMSRMMALELGVHKIRV 201

  Fly   188 CTIAPGLFNTPMLAALPEK--VRTFLAKSIP 216
            .:||||||.:.:...|.:|  ::....:::|
plant   202 NSIAPGLFKSEITQGLMQKEWLKNVTERTVP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 67/225 (30%)
AT3G55290NP_567019.1 fabG 18..271 CDD:235546 67/226 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.