DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and SDR2

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_190736.1 Gene:SDR2 / 824331 AraportID:AT3G51680 Length:303 Species:Arabidopsis thaliana


Alignment Length:274 Identity:86/274 - (31%)
Similarity:136/274 - (49%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGD-----KVVFVPVDVTS 61
            ::..|:::||||.|:|:||....|:.||:|::||:.:..|:.:||.|..     .|.|:..||:.
plant    32 LEGKVAIITGGAHGIGKATVMLFARHGATVVIADVDNVAGSSLAKSLSSHKTSPMVAFISCDVSV 96

  Fly    62 EKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVA-HRLEDFQRVININTVGTFNVIRL 125
            |.||...:.....::||||:..|.||.....|.   :|::. ...::|..|:.:|..|      :
plant    97 EADVENLVNVTVARYGRLDILFNNAGVLGDQKK---HKSILDFDADEFDHVMRVNVRG------V 152

  Fly   126 SAGLM-GANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICT 189
            ..|:. ||....:.|.:|.|::|||||...|.:|..||:|||.|:||:|...|.:|...|||:..
plant   153 GLGMKHGARAMIKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIVGLTKNAACELGKYGIRVNC 217

  Fly   190 IAPGLFNTPMLA-----------------ALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIYEN 237
            |:|....|.||.                 .:.|.||: ||.......|..:.:| |.|..|..|:
plant   218 ISPFGVATSMLVNAWRKTSGGDVEDDDVEEMEEFVRS-LANLKGETLRANDIAE-AALYLASDES 280

  Fly   238 PLLNGEVIRIDGAL 251
            ..:||..:.:||.:
plant   281 KYVNGHNLVVDGGV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 86/273 (32%)
SDR2NP_190736.1 PLN02253 23..296 CDD:177895 86/274 (31%)
NADB_Rossmann 31..295 CDD:304358 86/274 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 112 1.000 Domainoid score I2058
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.