DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and ATA1

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_189882.1 Gene:ATA1 / 823352 AraportID:AT3G42960 Length:272 Species:Arabidopsis thaliana


Alignment Length:206 Identity:67/206 - (32%)
Similarity:111/206 - (53%) Gaps:15/206 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVSAALQ 70
            |:::||||.|:|.|||....:.||.||:||:..::|..||:.:|.  .:|..||:.|.||.||::
plant    12 VAIITGGARGIGAATARLFTENGAYVIVADILENEGILVAESIGG--CYVHCDVSKEADVEAAVE 74

  Fly    71 TAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMGANEP 135
            .|..:.||||:..|.||     .:.|....:...::...:::::|..|..:.|:.:|..|     
plant    75 LAMRRKGRLDVMFNNAG-----MSLNEGSIMGMDVDMVNKLVSVNVNGVLHGIKHAAKAM----- 129

  Fly   136 NQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNTPML 200
            .:.|:.|.|:.|:|.:...|.:|..||:.||.|:.|:....|.:|.:.|||:.:|:|....|.:|
plant   130 IKGGRGGSIICTSSSSGLMGGLGGHAYTLSKGAINGVVRTTACELGSHGIRVNSISPHGVPTDIL 194

  Fly   201 AALPEKVRTFL 211
            .   ...|.||
plant   195 V---NAYRKFL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 67/206 (33%)
ATA1NP_189882.1 PLN02253 4..268 CDD:177895 67/206 (33%)
NADB_Rossmann 7..261 CDD:304358 67/206 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 112 1.000 Domainoid score I2058
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.