DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AT3G26760

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_189311.2 Gene:AT3G26760 / 822289 AraportID:AT3G26760 Length:300 Species:Arabidopsis thaliana


Alignment Length:267 Identity:80/267 - (29%)
Similarity:135/267 - (50%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVS 66
            ::..|:::||||||:|:||||....|||.||:.|:....|:.||.|||....|:..|||.|:.::
plant    36 LEGKVAVITGGASGIGKATAEEFVSQGAQVIIVDIDEEAGHMVATELGSAAHFLRCDVTEEEQIA 100

  Fly    67 AALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAH-RLEDFQRVININTVGTFNVIRLSAGLM 130
            .|::||..:.|:||:.:|.||.:.::..    .::|. .::.:.:|:.:|..||...|:.:|..|
plant   101 KAVETAVTRHGKLDVMLNSAGISCSISP----PSIADLDMDTYDKVMRLNVRGTVLGIKHAARAM 161

  Fly   131 ---GANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAP 192
               |:         |.|:..:|::...|.:|..|||.||..:.|:...:|.:|...|:||..|:|
plant   162 IPAGS---------GSILCLSSISGLMGGLGPHAYSISKFTIPGVVKTVASELCKHGLRINCISP 217

  Fly   193 GLFNTPMLAALPEKVRTFLAKSIPFPQRL----------GEPSEYAHLVQ-AIY----ENPLLNG 242
            ....||:...:..:  .|...||...|.|          ||..|...:.: |:|    :...:.|
plant   218 AGIPTPLTLRMFRE--AFAGHSIREEQLLAIVNATGELKGEKCEEIDVAKAALYLASDDAKFVTG 280

  Fly   243 EVIRIDG 249
            ..:.:||
plant   281 HNLVVDG 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 80/266 (30%)
AT3G26760NP_189311.2 PLN02253 30..291 CDD:177895 80/267 (30%)
NADB_Rossmann 35..290 CDD:304358 80/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 112 1.000 Domainoid score I2058
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I1969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1074094at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3543
orthoMCL 1 0.900 - - OOG6_102935
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.