DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and SDR5

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_566097.1 Gene:SDR5 / 819327 AraportID:AT2G47140 Length:257 Species:Arabidopsis thaliana


Alignment Length:255 Identity:73/255 - (28%)
Similarity:117/255 - (45%) Gaps:25/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELG-DKVVFVPVDVTSEKDVSAAL 69
            :.::||||||:|..:.....:.||.|::.|:....|..||..:| ||..:...|||:|.:|..|:
plant    10 IVIITGGASGIGAESVRLFTEHGARVVIVDVQDELGQNVAVSIGEDKASYYHCDVTNETEVENAV 74

  Fly    70 QTAKDKFGRLDLTVNCAGTATA-VKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMGAN 133
            :...:|:|:||:..:.||.... |...:.|      |.:..|.|.||..||...|:.:|..|   
plant    75 KFTVEKYGKLDVLFSNAGVIEPFVSILDLN------LNELDRTIAINLRGTAAFIKHAARAM--- 130

  Fly   134 EPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNTP 198
              .:.|.||.||.|.||||.........|:.||..::|:....:..|...|||:..:||....||
plant   131 --VEKGIRGSIVCTTSVAAEIAGTAPHGYTTSKHGLLGLIKSASGGLGKYGIRVNGVAPFGVATP 193

  Fly   199 MLA----ALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIY-----ENPLLNGEVIRIDG 249
            ::.    ..|..|....:.|....   |...:..|:.:|..     |:..::|:.:.:||
plant   194 LVCNGFKMEPNVVEQNTSASANLK---GIVLKARHVAEAALFLASDESAYVSGQNLAVDG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 73/255 (29%)
SDR5NP_566097.1 PLN02253 1..255 CDD:177895 73/255 (29%)
NADB_Rossmann 5..253 CDD:304358 73/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.