DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AT2G47120

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001325398.1 Gene:AT2G47120 / 819325 AraportID:AT2G47120 Length:259 Species:Arabidopsis thaliana


Alignment Length:261 Identity:81/261 - (31%)
Similarity:131/261 - (50%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELG-DKVVFVPVDVTSEKDV 65
            ::..:.::||||||:|...|......||.|::.|:....|..||..:| ||..|...|||:|.:|
plant     7 LEGKIVIITGGASGIGADAARLFTDHGAKVVIVDVQEELGQNVAVLIGKDKASFYRCDVTNETEV 71

  Fly    66 SAALQTAKDKFGRLDLTVNCAGTATAVKTF-NFNKNVAHRLEDFQRVININTVGTFNVIRLSAGL 129
            ..|::...:|.|:||:..:.||....:::| :|:      ||.|.|::.:|..|....|:.:|..
plant    72 EDAVKFTVEKHGKLDVLFSNAGVLEPLESFLDFD------LERFDRIMAVNVRGAAAFIKHAARA 130

  Fly   130 MGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGL 194
            |     .:.|.||.||.|.||:|..|. |...|:|||..:||:......||...|||:..:||..
plant   131 M-----VEKGTRGSIVCTTSVSAEIGG-GHHGYTASKHGLVGLIRSACGDLGKYGIRVNGVAPYA 189

  Fly   195 FNTPMLAALPEKVR------TFLAKSIPFPQRLGEPSEYAHLVQ-AIY----ENPLLNGEVIRID 248
            ..|||.:  .::|.      .|.||.|    ..|...:.:|:.| |::    ::..::|:.:.:|
plant   190 VATPMTS--HDEVTGKQLEDYFDAKGI----LKGMVLKASHVAQVALFLASDDSAYISGQNLAVD 248

  Fly   249 G 249
            |
plant   249 G 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 81/260 (31%)
AT2G47120NP_001325398.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1074094at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.