DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AT2G37540

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_181290.1 Gene:AT2G37540 / 818330 AraportID:AT2G37540 Length:321 Species:Arabidopsis thaliana


Alignment Length:240 Identity:64/240 - (26%)
Similarity:104/240 - (43%) Gaps:41/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL------GDKVVFVPVDVTSEKDV 65
            :::|||.||:|...|..||.:||.||:|.......|| :||:      ..:|.::.:||:|.|.|
plant    36 AIITGGTSGIGLEAARVLAMRGAHVIIAARNPKAANE-SKEMILQMNPNARVDYLQIDVSSIKSV 99

  Fly    66 SAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLED-FQRVININTVGTFNVIRLSAGL 129
            .:.:    |:|..|::.:|.......|....|...     || .:.....|.:|.|.:..|....
plant   100 RSFV----DQFLALNVPLNILINNAGVMFCPFKLT-----EDGIESQFATNHIGHFLLTNLLLDK 155

  Fly   130 MGANEPNQDGQRGVIVNTASVA---------AFDGQIGQA------AYSASKAAVVGMTLPIARD 179
            | .:...:.|.:|.|||.:|:|         .|.|....|      ||..||.:.:..:..::|.
plant   156 M-KSTARESGVQGRIVNLSSIAHTYTYSEGIKFQGINDPAGYSERRAYGQSKLSNLLHSNALSRR 219

  Fly   180 LSTQGIRIC--TIAPGLFNTPMLAALPEKVRTFLA------KSIP 216
            |..:|:.|.  ::.|||..|.:.......::.|.|      |:||
plant   220 LQEEGVNITINSVHPGLVTTNLFRYSGFSMKVFRAMTFLFWKNIP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 64/240 (27%)
AT2G37540NP_181290.1 retinol-DH_like_SDR_c_like 35..309 CDD:212492 64/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.