DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AT2G30670

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_180625.1 Gene:AT2G30670 / 817617 AraportID:AT2G30670 Length:262 Species:Arabidopsis thaliana


Alignment Length:267 Identity:79/267 - (29%)
Similarity:119/267 - (44%) Gaps:39/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKE---LGDKVVFVPVDVTSEK 63
            ::...:||||||||:|.|..|.||..||.:.:.|:..:..|:...|   .|.:|.....||:|..
plant     7 LQGMTALVTGGASGIGHAIVEELAGLGARIYVCDISETLLNQSLSEWEKKGFQVSGSICDVSSHS 71

  Fly    64 DVSAALQTAKDKF-GRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSA 127
            :....:||....| |:|::.||..|......|..:   ||   .||...|:.|....:::.:||.
plant    72 ERETLMQTVSKMFDGKLNILVNNVGVVNPKPTIEY---VA---ADFSFSISTNLESAYHLSQLSH 130

  Fly   128 GLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAP 192
            .|:.|:|      .|.|:..:||.........:.||.:|.|:..:...:|.:.:..|||..::||
plant   131 PLLKASE------FGSIIFISSVGGVVSMECGSIYSLTKGALNQLAKTLACEWARDGIRANSVAP 189

  Fly   193 GLFNTPMLAALP-------EKVRTFLAKSIPFPQRLGEPSEYAHLV------QAIYENPLLNGEV 244
            ....|.|  |.|       ||   .|....|. .|.|||:|.:.||      .|.|    :.|:.
plant   190 NFIYTAM--AQPFFKDADYEK---SLVSRTPL-GRAGEPNEVSSLVAFLCLPAASY----ITGQT 244

  Fly   245 IRIDGAL 251
            |.:||.|
plant   245 ICVDGGL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 79/266 (30%)
AT2G30670NP_180625.1 PRK09242 1..256 CDD:181721 79/267 (30%)
NADB_Rossmann 4..254 CDD:304358 79/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1074094at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.