DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AT2G29260

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_180489.1 Gene:AT2G29260 / 817475 AraportID:AT2G29260 Length:322 Species:Arabidopsis thaliana


Alignment Length:262 Identity:70/262 - (26%)
Similarity:118/262 - (45%) Gaps:39/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKE--------LGDKVVFVPVDVTSEK 63
            :|||||..|:|||..|.||..||.|     .:...||...|        .|.:|.....||:...
plant    73 ALVTGGTRGIGRAIVEELAGLGAEV-----HTCARNEYELENCLSDWNRSGFRVAGSVCDVSDRS 132

  Fly    64 DVSAALQTAKDKF-GRLDLTVNCAGTATAVKTFNFNK-NVAHRLEDFQRVININTVGTFNVIRLS 126
            ...|.::|....| |:|.:.||..||       |..| .|.....:|..:::.|....|::.:|:
plant   133 QREALMETVSSVFEGKLHILVNNVGT-------NIRKPMVEFTAGEFSTLMSTNFESVFHLCQLA 190

  Fly   127 AGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIA 191
            ..|:      ::.:.|.:|..:||:.|......:..|::|.|:..:|..:|.:.:...|||..:|
plant   191 YPLL------RESKAGSVVFISSVSGFVSLKNMSVQSSTKGAINQLTRSLACEWAKDNIRINAVA 249

  Fly   192 PGLFNTPMLAALPEKV---RTFLAK--SIPFPQRLGEPSEYAHLVQ--AIYENPLLNGEVIRIDG 249
            |....|.|:    |:|   :.:|.:  |:....|||||.|.:..|.  .:..:..:.|:::.:||
plant   250 PWYIKTSMV----EQVLSNKEYLEEVYSVTPLGRLGEPREVSSAVAFLCLPASSYITGQILCVDG 310

  Fly   250 AL 251
            .:
plant   311 GM 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 70/262 (27%)
AT2G29260NP_180489.1 NADB_Rossmann 65..315 CDD:419666 70/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.