DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and HSD17B8

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_055049.1 Gene:HSD17B8 / 7923 HGNCID:3554 Length:261 Species:Homo sapiens


Alignment Length:267 Identity:86/267 - (32%)
Similarity:136/267 - (50%) Gaps:29/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL-----------GDKVVFV 55
            :::|::||||..||:|||.:.|||.:||:|...||..:...|..:.|           |:...| 
Human     9 LRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAF- 72

  Fly    56 PVDVTSEKDVSAALQTAKDKFGR-LDLTVNCAGTATAVKTFNFNKNVAHRLE-DFQRVININTVG 118
            ..||:..:.....|:..:..|.| ..:.|:|||...       ::.:.|..| |:.:||.:|..|
Human    73 QADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQ-------DEFLLHMSEDDWDKVIAVNLKG 130

  Fly   119 TFNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQ 183
            ||.|.:.:|..:.:|     |.||.|:|.:|:....|.:||..|:||||.|:|:|...||:|...
Human   131 TFLVTQAAAQALVSN-----GCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRH 190

  Fly   184 GIRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQ--AIYENPLLNGEVIR 246
            |||..::.||...|||...:|:||...:.:.||. ..||:|.:.|.:|.  |..::..:.|..:.
Human   191 GIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPM-GHLGDPEDVADVVAFLASEDSGYITGTSVE 254

  Fly   247 IDGALRM 253
            :.|.|.|
Human   255 VTGGLFM 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 86/266 (32%)
HSD17B8NP_055049.1 BKR_SDR_c 13..260 CDD:187594 83/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.