DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and Hsd17b14

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_079606.3 Gene:Hsd17b14 / 66065 MGIID:1913315 Length:273 Species:Mus musculus


Alignment Length:236 Identity:75/236 - (31%)
Similarity:114/236 - (48%) Gaps:34/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVSAALQ 70
            |.:||||:.|:|.|........||.|:..|...:.|..:.:||.. .||:|.|||.|:|:...:.
Mouse    11 VVVVTGGSRGIGAAIVRAFVDSGAQVVFCDKDEAGGRALEQELSG-TVFIPGDVTQERDLQTLVS 74

  Fly    71 TAKDKFGRLDLTVNCAG--------TATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSA 127
            ....:||.||..||.||        ..|:.             :.|::::.:|.:||:.:|:|:.
Mouse    75 ETLSRFGHLDCVVNNAGYHPPAQLPEETSA-------------QGFRQLLEVNLLGTYTLIKLAL 126

  Fly   128 GLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAP 192
                   |:....||.|:|.:|:....||.....|.|:|.||..||..:|.|.|..|:|:..|:|
Mouse   127 -------PHLRKSRGNIINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRHGVRVNCISP 184

  Fly   193 GLFNTPM---LAALPEKVR-TFLAKSIPFP-QRLGEPSEYA 228
            |...||:   |||.....| |.|..::..| .|:|:|:|.|
Mouse   185 GNIWTPLWEELAASTSDPRATILEGTLAQPLGRMGQPAEVA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 75/236 (32%)
Hsd17b14NP_079606.3 NADB_Rossmann 1..256 CDD:304358 75/236 (32%)
fabG 8..251 CDD:235546 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.