DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and Decr2

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_741993.1 Gene:Decr2 / 64461 RGDID:71002 Length:292 Species:Rattus norvegicus


Alignment Length:265 Identity:86/265 - (32%)
Similarity:136/265 - (51%) Gaps:36/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL----GDKVVFVPVDVTS 61
            ::::.|:.:|||.||:|...||...:.|...::......:.:|.||:|    |.:.:.:.:||..
  Rat    25 LLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVSRSLPRVSEAAKKLVAATGKRCLPLSMDVRV 89

  Fly    62 EKDVSAALQTAKDKFGRLDLTVNCAG-----TATAVKTFNFNKNVAHRLEDFQRVININTVGTFN 121
            ...|.||:..|..:||::|:.:|||.     .|:|:   :||.        |:.|::|:|:||||
  Rat    90 PPAVMAAVDQALKEFGKIDILINCAAGNFLCPASAL---SFNA--------FKTVVDIDTLGTFN 143

  Fly   122 VIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIR 186
            |.|:      ..|.......|||||..:..:..||:.|....|:||||..||..:|.:...|.||
  Rat   144 VSRV------LYEKFFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIR 202

  Fly   187 ICTIAPG-LFNTPMLAAL--PEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIY-ENPL---LNGEV 244
            :.::||| :..|..|..|  |:....|...|.|.| |||..:|.||.|  :| .:||   ::|.|
  Rat   203 VNSLAPGAISGTEGLRRLGGPKASSKFKYLSSPIP-RLGTKTEIAHSV--LYLASPLASYVSGIV 264

  Fly   245 IRIDG 249
            :.:||
  Rat   265 LVVDG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 86/263 (33%)
Decr2NP_741993.1 TER_DECR_SDR_a 26..273 CDD:187627 86/264 (33%)
Substrate binding. /evidence=ECO:0000250 126..128 0/1 (0%)
Microbody targeting signal 290..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.