DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and rdh14

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001017231.1 Gene:rdh14 / 549985 XenbaseID:XB-GENE-1018384 Length:323 Species:Xenopus tropicalis


Alignment Length:237 Identity:61/237 - (25%)
Similarity:102/237 - (43%) Gaps:46/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL----GDK--VVFVPVDV 59
            :::....::||...|:|:|||..|.||.|.||||.....:..|.|.||    |::  :|...:|:
 Frog    39 LMRGKTVIITGANCGIGKATAAELVKQEARVILACRDQGRAEEAAAELRREAGERGEIVIKQLDL 103

  Fly    60 TSEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLED-FQRVININTVGTFNVI 123
            .|.:.|....|....:..|||:.:|.||......|         :.|| |:....:|.:|.|.:.
 Frog   104 GSLQSVRRFCQEVLKEEPRLDVLINNAGVFQCPYT---------KTEDGFEMQFGVNHLGHFLLT 159

  Fly   124 RLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIG------------QAAYSASKAAVVGMTLPI 176
            ....||:.::.|::     ::|.::.:..: |:|.            ...||.||.|.:..|..:
 Frog   160 HHLLGLLKSSAPSR-----IVVVSSKLYKY-GEINFDDLNSEKSYSRSFGYSRSKLANILFTREL 218

  Fly   177 ARDLSTQGIRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFP 218
            |..|...|:.:..:.||:            |||.|.:.|..|
 Frog   219 ASRLEGTGVTVNALHPGI------------VRTNLGRHINIP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 61/235 (26%)
rdh14NP_001017231.1 NADB_Rossmann 42..315 CDD:389744 61/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.