DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AgaP_AGAP007879

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_001689047.1 Gene:AgaP_AGAP007879 / 4578212 VectorBaseID:AGAP007879 Length:341 Species:Anopheles gambiae


Alignment Length:216 Identity:48/216 - (22%)
Similarity:95/216 - (43%) Gaps:28/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL----GDKVVFVPVDVTSEKDVSA 67
            :::||.:.|:|:..|..||.:|.:::|....::|.|:||.|:    |.:...:..|.:...::..
Mosquito    50 AVITGASDGIGKGYAHYLAAKGMAIVLVARNAAKLNKVADEIRAKHGVETKVLVADFSKGAEIYP 114

  Fly    68 ALQTAKDKFGRLDLTVNCAGTATAVKTFNF----------------NKNVAHRLEDFQRVININT 116
            .|:.|     .:.|.|...|......:|..                |..|:|....:...:...|
Mosquito   115 QLEKA-----LVPLDVGILGKCRLHASFPSPSHCNTLIGVWFCTVNNVGVSHDTPMYVDEVPQQT 174

  Fly   117 VGTFNVIRLSAGLMGAN--EPN-QDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIAR 178
            :.....:.::|..:..|  .|: :..|||:|:|.:|:|:.......|.|:||||.:...::.:..
Mosquito   175 LWDLIHVNVAAATLLCNILAPSMKRRQRGLIINVSSIASVGPSPCMATYAASKAYMTSFSIALRD 239

  Fly   179 DLSTQGIRICTIAPGLFNTPM 199
            :|...|:.:.|:.|...:|.|
Mosquito   240 ELRPFGVEVQTVRPSFVHTNM 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 48/216 (22%)
AgaP_AGAP007879XP_001689047.1 17beta-HSD1_like_SDR_c 47..314 CDD:187614 48/216 (22%)
adh_short 48..261 CDD:278532 48/216 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.