DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AgaP_AGAP005500

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_001237675.1 Gene:AgaP_AGAP005500 / 4576326 VectorBaseID:AGAP005500 Length:245 Species:Anopheles gambiae


Alignment Length:209 Identity:53/209 - (25%)
Similarity:98/209 - (46%) Gaps:31/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVI-LA---DLPSSKGNEVAKELGDKVVFVPVDVTSEKDVS 66
            |::|||.:||:|.|||:.|.:.|..|: ||   :...:..||:...:..::..:..||..|:|:.
Mosquito     8 VAVVTGASSGIGAATAKALVRAGMIVVGLARRVERIEALRNELPANVPGQLHAIRCDVMREEDIL 72

  Fly    67 AALQTAKDKFGRLDLTVNCAGTA-TAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLM 130
            ||....:.:||.:|:.:|.||.| ..|:....|..     :..:.:::.:.:|.....|  ...:
Mosquito    73 AAYAQIERQFGGVDVQINSAGIAHHTVRILQPNNT-----QPLRDIVHTDLLGLTLCSR--EAYL 130

  Fly   131 GANEPNQDGQRGVIVNTASVAAFDGQIGQA--------AYSASKAAVVGMTLPIARDLSTQG--I 185
            ...:.:.||.   ||:..|:.      |.:        .|.|.|..|..:|..:.::|...|  :
Mosquito   131 SMQKRSVDGH---IVHLNSIT------GHSIPPLNTLNIYPAVKHGVTALTETMRQELRFAGSKV 186

  Fly   186 RICTIAPGLFNTPM 199
            ::.:|:|||..||:
Mosquito   187 KVTSISPGLTRTPI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 53/209 (25%)
AgaP_AGAP005500XP_001237675.1 NADB_Rossmann 1..240 CDD:304358 53/209 (25%)
YdfG 6..244 CDD:226674 53/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.