DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and sro

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster


Alignment Length:210 Identity:51/210 - (24%)
Similarity:81/210 - (38%) Gaps:40/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATA---------------ERLAKQGASVILADLPSSKGNEVAKELGDKVVFV 55
            |.|:||..||||.:.|               ..:..:||.::       :|...||:...::..:
  Fly    28 VVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLL-------QGLASAKDGLSRMHTL 85

  Fly    56 PVDVTSEKDVSAALQ-----TAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININ 115
            .:|:.....:....:     .|||...||...:|.||...      |.:......|..:..||.|
  Fly    86 ELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMC------FGEFEWQLTEQIEAQINCN 144

  Fly   116 TVGTFNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDL 180
            .:||   :||:..|:    |....|:|.|:|..|............|:|||||:...|..:..:|
  Fly   145 LLGT---MRLTHELL----PLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVEL 202

  Fly   181 STQGIRICTIAPGLF 195
            ...|:.:....||.|
  Fly   203 QQYGMEVVNFIPGSF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 51/210 (24%)
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 51/210 (24%)
adh_short 28..229 CDD:278532 51/210 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.