DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG7601

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:235 Identity:53/235 - (22%)
Similarity:96/235 - (40%) Gaps:33/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL-------GDKVVFVPVDVTSEK 63
            |.|:||.:||||.:.|....:.|..||||...:.:...|.|:|       ......:|:|:....
  Fly    55 VVLITGASSGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLALDVDPAYPPTVLPLDLAELN 119

  Fly    64 DVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAG 128
            .:...:......:.::|:.:|..|       .:...:||....|..  :.:..|..|..:.|:..
  Fly   120 SIPEFVTRVLAVYNQVDILINNGG-------ISVRADVASTAVDVD--LKVMVVNYFGSVALTKA 175

  Fly   129 LMGANEPNQDGQRGVIVNTASVAAFDGQIG---QAAYSASKAAVVGMTLPIARDLSTQGIRICTI 190
            |:.:......|      :...:::..|:..   :|||||||.|:......:..:::.:.|.:..:
  Fly   176 LLPSMVKRGSG------HICFISSVQGKFAIPQRAAYSASKHAMQAFADSLRAEVANKNINVSCV 234

  Fly   191 APGLFNTPM-LAALP------EKVRTFLAKSIPFPQRLGE 223
            :||...|.: |.||.      .||....||.:. |.:|.|
  Fly   235 SPGYIRTQLSLNALTGSGSSYGKVDETTAKGMS-PDKLAE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 53/235 (23%)
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 53/235 (23%)
PRK06181 53..314 CDD:235726 53/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.