DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG10425

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_651363.1 Gene:CG10425 / 43043 FlyBaseID:FBgn0039304 Length:336 Species:Drosophila melanogaster


Alignment Length:199 Identity:62/199 - (31%)
Similarity:94/199 - (47%) Gaps:20/199 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTGGASGLGRATAERLAKQGA--SVILADLPSSKG----NEVAKELGD-KVVFVPVDVTSEKD- 64
            :||||:.|:|...|...|.:||  :||..|.....|    .||.::..| |..:..:|::.:.| 
  Fly    39 VVTGGSKGIGLCLAVECAMKGANVTVIARDEKMLSGAVALMEVIRQRPDQKFQYRSLDISGDYDQ 103

  Fly    65 VSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGL 129
            |:..|...:|.||.:...:||||.|..    ...:.|:  ::|..:::|:|..||:|..|.....
  Fly   104 VAKVLGEIEDSFGPIYTLINCAGMAIC----GVFEEVS--VQDVHKLMNVNFFGTYNCTRYVLPK 162

  Fly   130 MGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGL 194
            |      :....|:||.|||.||..|..|...|||:|.|:..|...||.:....|:.:....|..
  Fly   163 M------KKAGDGIIVITASQAAMFGIYGYGPYSATKYALRAMAETIAMESREHGVSVTLAMPCD 221

  Fly   195 FNTP 198
            .|||
  Fly   222 TNTP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 62/199 (31%)
CG10425NP_651363.1 KDSR-like_SDR_c 35..271 CDD:187643 62/199 (31%)
adh_short 36..229 CDD:278532 62/199 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.